Enfuvirtide drug data and news

Enfuvirtide drug data, resources, and news articles (when available). Onconews.org provides news on cancer research. This section, which includes profiles on medicines that may or not be cancer-related is in beta form. If things run smoothly we will be releasing a new format late in the summer of 2006.

Generic name Enfuvirtide
Brand Names/Synonyms Envelope polyprotein GP160 precursor [Contains: Exterior membrane glycoprotein;GP120; Transmembrane glycoprotein;GP41]; Fuzeon (Roche Pharmaceuticals)
Indication For treatment of HIV AIDS
Sponsored links
Description 36 residue synthetic peptide that inhibits HIV-1 fusion with CD4 cells. N-terminal acetylated, C-terminal amide.
Pharmacology Not Available
Mechanism Of Action Not Available
Enfuvirtide News
(When available)

Drug may lower HIV rates  Mar 2, 2006
The drug nevirapine - sold under the brand name Viramune - was found to prevent the spread of HIV infection from mother to infant during childbirth, according ... - myDNA.com,

Medivir: Candidate Drug Designated  Feb 9, 2006
...currently amount to around SEK 8 billion and the market is dominated by two products, Sustiva (Bristol Myer Squibb) and Viramune (Boehringer Ingelheim). ... - Genetic Engineering News,

CROI News Feature: Experts divided over the future of treatment ...  Feb 9, 2006
...below 100 cells/mm 3 (the median CD4 nadir was, in fact, 280 cells/mm 3 ), and it excluded anyone taking abacavir (Ziagen) or nevirapine (Viramune, or those ... - Aidsmap,

CROI: etravirine (TMC125) and darunavir (TMC114) in treatment ...  Feb 13, 2006
...in EC 50 (50% maximum effective concentration) to etravirine was 1.7, compared with about 40 for efavirenz (Sustiva) and about 60 for nevirapine (Viramune). ... - Aidsmap,

Multi-component drug delivery system: An emerging trend  Feb 8, 2006
Non-nucleoside Reverse Transcriptase Inhibitors (NnRTIs), which include delavirdine (Rescriptor), efavirenz (Sustiva), and nevirapine (Viramune). ... - Express Pharma Pulse,

Medivir: Candidate Drug Designated  09 Feb 2006
...currently amount to around SEK 8 billion and the market is dominated by two products, Sustiva (Bristol Myer Squibb) and Viramune (Boehringer Ingelheim). ... - Genetic Engineering News,

Multi-component drug delivery system: An emerging trend  Feb 8, 2006
Non-nucleoside Reverse Transcriptase Inhibitors (NnRTIs), which include delavirdine (Rescriptor), efavirenz (Sustiva), and nevirapine (Viramune). ... - Express Pharma Pulse,

Almost a third of Indian patients make changes to first-line ...  Jan 19, 2006
Even so, the study does make a number of interesting observations — including a high rate of nevirapine (Viramune)-related liver toxicity in persons also ... - Aidsmap,

Study compares HIV treatment options  Jan 31, 2006
...day. If intolerable side effects were felt from the efavirenz, nevirapine (Viramune) was administered twice daily in its place. ... - myDNA.com,

ICAAC: Nevirapine’s manufacturer examines rates of liver ...  Jan 9, 2006
The high rates of liver side-effects seen in a major study of nevirapine (Viramune) may have been driven by unusual results from one study centre, according to ... - Aidsmap,

Get News from  Jan 8, 2006
This product is the first generic version of the approved product, Viramune Oral Suspension, 50 mg /5 ml, manufactured by Boehringer Ingelheim Pharmaceuticals. ... - Myiris.com,

World AIDS Day 2005 – Boehringer Ingelheim is committed to its ...  Nov 28, 2005
In addition to the well-established Boehringer Ingelheim programmes, like the Viramune® Donation Program, reduced pricing schemes for chronic Viramune ... - PharmaLive.com (press release),

New Data Demonstrate Efficacy of Two Leading  Nov 21, 2005
...to other anti-HIV medications.(1) In addition, researchers presented new safety and efficacy analyses from a head-to-head study of VIRAMUNE(R) (nevirapine) and ... - APA OTS (Pressemitteilung),

Psychiatric Manifestations of HIV Infection and AIDS  Dec 5, 2005
The other members of the NNRTI medication class, delavirdine (Rescriptor) and nevirapine (Viramune), have not been associated with significant CNS adverse ... - Psychiatric Times,

APTIVUS(R) Sustains Convincing Anti-HIV  Nov 21, 2005
VIRAMUNE(R) (nevirapine) is a product of original research done at Boehringer Ingelheim. VIRAMUNE(R) was the first member of the ... - APA OTS (Pressemitteilung),

Aptivus Sustains Convincing Anti-HIV Effect Through 48 Weeks  Nov 21, 2005
Viramune® (nevirapine) is a product of original research done at Boehringer Ingelheim. Viramune® was the first member of the non ... - PharmaLive.com (press release),

The Curious Case of The One-Eyed Sheep  Nov 15, 2005
Julian Adams, the superstar chemist who invented the AIDS drug Viramune and cancer drug Velcade, has made a hedgehog inhibitor one of his lead medicines at ... - Forbes

TMC125 is safe and effective in patients with NNRTI resistance  Nov 24, 2005
The currently available NNRTIs efavirenz (Sustiva) and nevirapine (Viramune) are potent anti-HIV drugs that can reduce viral loads and increase CD4 cell counts ... - Aidsmap,

Anti-HIV drug from rainforest almost lost before its discovery  Sep 13, 2005
Approved NNRTIs include Viramune® (nevirapine) from Boehringer Ingelheim, Sustiva® (efavirenz) from Bristol-Myers Squibb, and Rescriptor® (delavirdine) from ... - Mongabay.com

Dosage Forms Not Available
Drug_Category Anti-HIV Agents
Absorption Not Available
Interactions Not Available
Toxicity Not Available
Organisms Affected Human immunodeficiency virus
Chemical IUPAC Name YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF
Chemical Formula C202H298N50O64
Molecular Weight 4450.8
Smiles String Not Available
Melting Point Not Available
Water Solubility Not Available
State Transparent, slightly viscous, aqueous liquid
LogP/Hphobicity -0.875
Isoelectric Point 4.3
Biotransformation Not Available
Half Life 3.8 +/- 0.6 hrs
Protein Binding [%] 92%
RxList Link RXlist
Sponsored links
Drug Reference http://www.drugs.com/cons/Enfuvirtide.html
http://www.rxlist.com/cgi/generic3/fuzeon.htm
Drug Type Approved Drug
Accession No BIOD00106
CAS Registry Number 159519-65-0
KEGG Compound ID Not Available
PubChem ID SID:623635
PharmGKB ID PA10262
SwissProt ID ENV_HV1LW (Q70626)
GenBank ID U12055
Drug ID Number [DIN] Not Available

Home | About | Cancers | Treatment | Medications
Copyright onconews.org 2005.
All Rights Reserved.
Google
 
Web onconews.org