|
![]() |
|
|
Enfuvirtide
drug data and news
Enfuvirtide drug data, resources, and news articles (when available). Onconews.org provides news on cancer research. This section, which includes profiles on medicines that may or not be cancer-related is in beta form. If things run smoothly we will be releasing a new format late in the summer of 2006.
|
| Generic name | Enfuvirtide | ||
| Brand Names/Synonyms | Envelope polyprotein GP160 precursor [Contains: Exterior membrane glycoprotein;GP120; Transmembrane glycoprotein;GP41]; Fuzeon (Roche Pharmaceuticals) | ||
| Indication | For treatment of HIV AIDS | ||
| Sponsored links | Description | 36 residue synthetic peptide that inhibits HIV-1 fusion with CD4 cells. N-terminal acetylated, C-terminal amide. | |
| Pharmacology | Not Available | ||
| Mechanism Of Action | Not Available | ||
| Enfuvirtide News (When available) |
Drug may lower HIV rates Mar 2, 2006 Medivir: Candidate Drug Designated Feb 9, 2006 CROI News Feature: Experts divided over the future of treatment ... Feb 9, 2006 CROI: etravirine (TMC125) and darunavir (TMC114) in treatment ... Feb 13, 2006 Multi-component drug delivery system: An emerging trend Feb 8, 2006 Medivir: Candidate Drug Designated 09 Feb 2006 Multi-component drug delivery system: An emerging trend Feb 8, 2006 Almost a third of Indian patients make changes to first-line ... Jan 19, 2006 Study compares HIV treatment options Jan 31, 2006 ICAAC: Nevirapine’s manufacturer examines rates of liver ... Jan 9, 2006 Get News from Jan 8, 2006 World AIDS Day 2005 – Boehringer Ingelheim is committed to its ... Nov 28, 2005 New Data Demonstrate Efficacy of Two Leading Nov 21, 2005 Psychiatric Manifestations of HIV Infection and AIDS Dec 5, 2005 APTIVUS(R) Sustains Convincing Anti-HIV Nov 21, 2005 Aptivus Sustains Convincing Anti-HIV Effect Through 48 Weeks Nov 21, 2005 The Curious Case of The One-Eyed Sheep Nov 15, 2005 TMC125 is safe and effective in patients with NNRTI resistance Nov 24, 2005 Anti-HIV drug from rainforest almost lost before its discovery Sep 13, 2005 | ||
| Dosage Forms | Not Available | ||
| Drug_Category | Anti-HIV Agents | ||
| Absorption | Not Available | ||
| Interactions | Not Available | ||
| Toxicity | Not Available | ||
| Organisms Affected | Human immunodeficiency virus | ||
| Chemical IUPAC Name | YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF | ||
| Chemical Formula | C202H298N50O64 | ||
| Molecular Weight | 4450.8 | ||
| Smiles String | Not Available | ||
| Melting Point | Not Available | ||
| Water Solubility | Not Available | ||
| State | Transparent, slightly viscous, aqueous liquid | ||
| LogP/Hphobicity | -0.875 | ||
| Isoelectric Point | 4.3 | ||
| Biotransformation | Not Available | ||
| Half Life | 3.8 +/- 0.6 hrs | ||
| Protein Binding [%] | 92% | ||
| RxList Link | RXlist | ||
| Sponsored links | |||
| Drug Reference |
http://www.drugs.com/cons/Enfuvirtide.html http://www.rxlist.com/cgi/generic3/fuzeon.htm | ||
| Drug Type | Approved Drug | ||
| Accession No | BIOD00106 | ||
| CAS Registry Number | 159519-65-0 | ||
| KEGG Compound ID | Not Available | ||
| PubChem ID | SID:623635 | ||
| PharmGKB ID | PA10262 | ||
| SwissProt ID | ENV_HV1LW (Q70626) | ||
| GenBank ID | U12055 | ||
| Drug ID Number [DIN] | Not Available |
|
Home | About | Cancers | Treatment | Medications Copyright onconews.org 2005. All Rights Reserved. |